PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10015913
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 427aa    MW: 45747.9 Da    PI: 8.283
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10015913genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.96.9e-16230287360
                  XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                  ++kr rr+ +NRe+ArrsR+RK+a + eLe+ v +L   N++L k+l+ ++ ++ +  
  Lus10015913 230 DVKRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRDDNSSLLKRLSDISHKYNQSS 287
                  689********************************************99998887655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-19228292IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.473230285IPR004827Basic-leucine zipper domain
PfamPF001707.6E-14231284IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.21E-11231282No hitNo description
Gene3DG3DSA:1.20.5.1703.8E-13232285No hitNo description
PROSITE patternPS000360235250IPR004827Basic-leucine zipper domain
PfamPF124982.3E-31299420IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MDRVFSVDGM SDQFWSPPSP PPPNHQRHRH LPAPSPPPTV DGSSKMNRSA SEWAFQRFLQ  60
EASSAAPSDS ERSDVVHVNK DHRGNSSSSS SINAANGAAS ASTAPPEIPV DSEEYHAFLK  120
SKLNLACAAV ALSRGSYLKA QDSSGRADSG SQASNNSQVG SNTPSKGGND LSGSISKDSD  180
DPVEIPSLPT TLKRSAVLMK STTSGSSRDQ SEDDENEEEF ATADNTNPAD VKRVRRMLSN  240
RESARRSRRR KQAHLTELET QVSQLRDDNS SLLKRLSDIS HKYNQSSVDN RVLKADVETL  300
RTKVKMAEET VKRITGVTTI FQVRKEMSTA SIPSSSDTSA DASVPASKHH TNHSPTKPSS  360
NTESRGNNCM SDVSTVENGQ SDDGAGGGPA VTIGNKIGQK ASLRRIASLE HLQKRIRGEA  420
SSNGEQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1244251RRSRRRKQ
2246251SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011038579.11e-141PREDICTED: light-inducible protein CPRF2-like isoform X2
SwissprotQ990901e-106CPRF2_PETCR; Light-inducible protein CPRF2
TrEMBLB9SZ771e-136B9SZ77_RICCO; Light-inducible protein CPRF-2, putative
STRINGPOPTR_0013s03800.11e-130(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41763358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.25e-75bZIP family protein